General Information of Synthetic Binding Protein (SBP) (ID: SBP001723)
SBP Name
scFv anti-MCD M8
Synonyms
scFv M8
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
SBP Sequence
>VH Chain
QVQLVQSGGGLVKPGGSLRVSCSTSGFTESNAWMSWVRQAPGKGLEWLGRIKSKPAGGTI
DYAASVKGRFTISRDDSQGTLYLQMDTLKTEDTAVYYCTRSESLGAYYNWGQGTLVTVSS
>VL Chain
EIVMTQSPSSVSASVGDRVTITCRASQDISRWLAWYQQKPGKVPKRLIYAASILQNGVPS
RFSGSGSGTEFLTISSLQAEDFATYYCLQHSNYPWTFGQGTKLDIKRG
Template Name VH3 subgroup and VLkappa subgroup I
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Malonyl-CoA decarboxylase, mitochondrial
BTS Info
Binder Research tool N.A. Kangwon National University [1]
References
1 Isolation of two distinct populations of recombinant antibody molecules specific for rat malonyl-CoA decarboxylase from a semi-synthetic human scFv display library using Ex-phage system. Immunol Lett. 2004 Feb 15;91(2-3):163-70.