Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001679)
SBP Name
scFv anti-Fluorescein clone 12
Synonyms
scFv 12
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
SBP Sequence
>VH Chain
EVQLQQSGPELVKPGASVKISCKATGYAFSSYRIEWVKQRPGQGLEWIGVINPGSGGTNY
NEKFKGKAALTADKSSSTAYMQLSSLTSEDSAVYYCARRGNYYFDYWGQGTTLTVSS
>VL Chain
DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQQKPGQSPKALIHSASYRYSGVPD
RFTGSGSGTDFTLTISNVQSEDLAEYFCRQYNSHPWTFGGGTKLELKR
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1] , [2]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Fluorescein
BTS Info
Binder Tools for tailoring in vitro evolution for protein affinity or stability Kd: 1.1 nM University of Zurich; University of Hamburg [1] , [2]
References
1 Tailoring in vitro evolution for protein affinity or stability. Proc Natl Acad Sci U S A. 2001 Jan 2;98(1):75-80.
2 Comparison of Escherichia coli and rabbit reticulocyte ribosome display systems. FEBS Lett. 1999 Apr 30;450(1-2):105-10.