Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001662)
SBP Name
scFv anti-Melanoma cell clone E13
Synonyms
scFv E13
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
SBP Sequence
>VH Chain
AGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWGLRGEEGDYYVDV WGK
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Melanoma cells
BTS Info
Binder Research tool N.A. Yale University [1]
References
1 Comparison of fusion phage libraries displaying VH or single-chain Fv antibody fragments derived from the antibody repertoire of a vaccinated melanoma patient as a source of melanoma-specific targeting molecules. Proc Natl Acad Sci U S A. 1997 Aug 19;94(17):9261-6.