Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001661) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-Melanoma cell clone B73
|
|||||
Synonyms |
scFv B73
|
|||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
SBP Sequence |
>VH Chain
GGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAAISGSGGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWGLRGEEGDYYMDVWGK |
|||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Melanoma cells | Binder | Research tool | N.A. | Yale University | [1] | |