Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001659)
SBP Name
scFv anti-Melanoma cell clone S5
Synonyms
scFv S5
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
SBP Sequence
>VH Chain
GGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAAISGSGGSTYYADSVKGR
FTISRDNSKNTLYLQMNSLRAEDTAVYYCARGWGLRGEEGDYYMDVWGK
>VL Chain
PRGGGTQLTVL
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Melanoma cells
BTS Info
Binder Melanoma [ICD-11: 2C30] N.A. Yale University [1]
References
1 Comparison of fusion phage libraries displaying VH or single-chain Fv antibody fragments derived from the antibody repertoire of a vaccinated melanoma patient as a source of melanoma-specific targeting molecules. Proc Natl Acad Sci U S A. 1997 Aug 19;94(17):9261-6.