Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001652) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-HIV-1 clone 2-16
|
|||||
Synonyms |
scFv 2-16
|
|||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | High-throughput expression | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Template Name | scFv D5 | |||||
Template Sequence |
>Heavy Chain
QVQLVQSGAEVRKPGASVKVSCKASGDTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANY AQKGRVTITADESTSTAYMELSSLRSEDTAIYYCARDNPTLLGSDYWGKGTLVTVSS >Light Chain DIQMTQSPSTLSASIGDRVTITCRASEGIYHWLAWYQQKPGKAPKLLIYKASSLASGAPS RFSGSGTDFTLTISSLQPDDFATYYCQQYSNYPLTFGGGTKLEIKRA |
|||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Envelope glycoprotein gp160 | Binder | Human immunodeficiency virus type 1 infection [ICD-11: XN8LD] | N.A. | Merck Research Laboratories | [1] | |