Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001622) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-GA-pyridine 73MuH19
|
|||||
Synonyms |
scFv 73MuH19
|
|||||
Molecular Weight | 26.1 kDa | |||||
Thermal Denaturation TEMP | 65 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 242 | |||||
SBP Sequence |
>scFv anti-GA-pyridine 73MuH19
QVKLQQSGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKFEYLGYISYSGRTYYN PSLKSTISITRDTSKNQYYLQLNSVTTEDTATYYCSRPYYRYGYAIDYWGQGTTVTVSSG GGGSGGGGSGGGGSDIELTQSPAIMSASLGERVTMTCTASSSVSSSYLHWYQQKPGSSPK LWIYSTSNLASGVPARFSSSGSGTSYSLTISRMEAEDAATYYCQQSRKAPYTFGGGTKLE IK |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
3-hydroxy-4-hydroxymethyl-1-(5-amino-5-carboxypentyl) pyridinium cation | Binder | Tools for reducing inter-domain motion | Kd: 230 nM | Kumamoto University | [1] | |