Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001574) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab anti-Lol-pII clone I
|
|||||
| Synonyms |
Fab clone I
|
|||||
| Molecular Weight | 50 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Heavy Chain
QVQLVQSGAEVKKPGATVKISCKASGYTFIDYYMHNVQQAPGKGLENMGLVDPEDGETIY AEKFQGRVTITADTSTDTAYMFLSSLRSEDTAVYYCARGSVGLKWGQGTLVTVSS >Light Chain QAVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWTQQTPGQAPRTLIYSTNTRSSGV PDRFSGSILGNKAGLTITGGQADDESDYYCVLYMGSGLVFGGGTKLTVLG |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Lolium perenne allergen Lol pII | Inhibitor | Allergy [ICD-11: 4A80-4A85] | Kd: 2.6 nM | San Raffaele Scientific Institute | [1] | |