General Information of Synthetic Binding Protein (SBP) (ID: SBP001556)
SBP Name
Fab anti-NP 9TG
Synonyms
Fab 9TG
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Phage display
Highest Status Research
SBP Sequence
>Heavy Chain
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKY
NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARGRYGLHFDYWGQGTTLTVSS
>L Chain:QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG
Protein Scaffold Information of This SBP
Scaffold ID PS034
Scaffold Info
[1]
Scaffold Name Fab
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
4-hydroxy-3-nitrophenyl acetyl
BTS Info
Binder Research tool N.A. Age Dimension Research Center [1]
References
1 Efficient bacterial production of functional antibody fragments using a phagemid vector. Protein Expr Purif. 2008 Apr;58(2):292-300.