Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001556) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab anti-NP 9TG
|
|||||
| Synonyms |
Fab 9TG
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli XL1-Blue | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Heavy Chain
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKY NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARGRYGLHFDYWGQGTTLTVSS >L Chain:QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLG |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| 4-hydroxy-3-nitrophenyl acetyl | Binder | Research tool | N.A. | Age Dimension Research Center | [1] | |