Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001329) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-c-Src 2G10
|
|||||
| Synonyms |
Monobody 2G10
|
|||||
| Molecular Weight | 9.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 90 | |||||
| SBP Sequence |
>Monobody anti-c-Src 2G10
VSDVPRDLEVVAATPTSLLISWDAPRTPKHYYRITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVDYTITVYLYQLPLPSKPISINYRT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Fibronectin type III domain (FN3) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase Src | Binder | Research tool | N.A. | Biosciences Division | [1] | |