General Information of Synthetic Binding Protein (SBP) (ID: SBP001328)
SBP Name
Monobody anti-c-Src 1F10
Synonyms
Monobody 1F10
Molecular Weight 9.7 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
Sequence Length 90
SBP Sequence
>Monobody anti-c-Src 1F10
VSDVPRDLEVVAATPTSLLISWDAPMALTAYYRITYGETGGNSPVQEFTVPGSKSTATIS
GLKPGVDYTITVYAYQRALPSKPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Proto-oncogene tyrosine-protein kinase Src
BTS Info
Binder Research tool N.A. Biosciences Division [1]
References
1 Molecular recognition properties of FN3 monobodies that bind the Src SH3 domain. Chem Biol. 2004 Jun;11(6):835-44.