Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001325)
SBP Name
Monobody anti-Keap1 R1
Synonyms
Monobody R1
Molecular Weight 10.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 95
SBP Sequence
>Monobody anti-Keap1 R1
VSDVPRDLEVVAATPTSLLISWDRAYGYPSRYYRITYGETGGNSPVQEFTVPGSKSTATI
SGLKPGVDYTITVYAVRDEETGEFHWPPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Kelch-like ECH-associated protein 1
BTS Info
Inhibitor Tools as inhibitor of the KEAP1-NRF2 interaction Kd: 0.3 nM Department of Biochemistry and Biophysics [1]
References
1 Engineering a genetically encoded competitive inhibitor of the KEAP1-NRF2 interaction via structure-based design and phage display. Protein Eng Des Sel. 2016 Jan;29(1):1-9.