General Information of Synthetic Binding Protein (SBP) (ID: SBP001320)
SBP Name
Monobody anti-Lyn H4
Synonyms
Monobody H4
Molecular Weight 10.0 kDa
Thermal Denaturation TEMP 88 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 91
SBP Sequence
>Monobody anti-Lyn H4
VSDVPRDLEVVAATPTSLLISWDAPSSFRNYYRITYGETGGNSPVQEFTVPGSKSTATIS
GLKPGVDYTITVYAVTRRENFSKPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tyrosine-protein kinase Lyn
BTS Info
Binder Tools as affinity reagents to probe Fyn N.A. University of Illinois at Chicago [1]
References
1 Isolation of monobodies that bind specifically to the SH3 domain of the Fyn tyrosine protein kinase. N Biotechnol. 2012 Jun 15;29(5):526-33.