Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001289)
SBP Name
Monobody anti-Abl-SH2 HA18
Synonyms
Monobody HA18
Molecular Weight 9.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 94
SBP Sequence
>Monobody anti-Abl-SH2 HA18
GSSVSSVPTKLEVVAATPTSLLISWDAYYYSSWGVGYYRITYGETGGNSPVQEFTVPGSS
STATISGLSPGVDYTITVYAYWGDYWPVHSPISINYRTC
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name 10th domain of fibronectin type III (10Fn3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tyrosine-protein kinase ABL1
BTS Info
Inhibitor Research tool N.A. University of Chicago [1] , [2]
References
1 A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain. Nat Struct Mol Biol. 2010 Apr;17(4):519-27.
2 The fibronectin type III domain as a scaffold for novel binding proteins. J Mol Biol. 1998 Dec 11;284(4):1141-51.