General Information of Synthetic Binding Protein (SBP) (ID: SBP001285)
SBP Name
Monobody anti-MAPK p38 alpha clone G4mb
Synonyms
Monobody G4mb
Molecular Weight 10.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Yeast display
Highest Status Research
Sequence Length 95
SBP Sequence
>Monobody anti-MAPK p38 alpha clone G4mb
VSDVPRDLEVVAATPTSLLISWDPPRCRRIRYYRITYGETGGNSPVQEFTVPGSKSTATI
SGLKPGVDYTITVYAVTGMPGLKIPRKPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Monobody 674mb
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Mitogen-activated protein kinase 14
BTS Info
Binder Research tool N.A. University of North Carolina at Chapel Hill [1]
References
1 Engineering a Protein Binder Specific for p38 with Interface Expansion. Biochemistry. 2018 Jul 31;57(30):4526-4535.