Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001283) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-MAPK p38 alpha clone 674mb
|
|||||
Synonyms |
Monobody 674mb
|
|||||
Molecular Weight | 10.1 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 94 | |||||
SBP Sequence |
>Monobody anti-MAPK p38 alpha clone 674mb
VSDVPRDLEVVAATPTSLLISWVPPWRPVRYYRITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVDYTITVYAVNGIGPQLTIPDGISINYRT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Mitogen-activated protein kinase 14 | Binder | Research tool | N.A. | University of North Carolina at Chapel Hill | [1] | |