Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001270) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-Ec2 clone S9
|
|||||
| Synonyms |
Monobody Ec2-S9
|
|||||
| Molecular Weight | 10.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display and yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 95 | |||||
| SBP Sequence |
>Monobody anti-Ec2 clone S9
VSSVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVDYTITVYTMYYSYSDLYSYSSPISINYRT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Fibronectin type III domain (FN3) | |||||
| Template Sequence Description | X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fluc channel homologue Ec2 | Blocker | Research tool | N.A. | Brandeis University | [1] | |