Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001238) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-BgaD-D clone S10
|
|||||
| Synonyms |
Monobody BgaD_S10
|
|||||
| Molecular Weight | 9.8 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display and yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 92 | |||||
| SBP Sequence |
>Monobody anti-BgaD-D clone S10
VSSVPTKLEVVAATPTSLLISWDAPAVTVVFYLITYGETGASSWPGYQEFTVPGSKSTAT ISGLKPGVDYTITVYAQYPWDTGSPISINYRT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | 10th domain of fibronectin type III (10Fn3) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| BgaD-D | Binder | Tools for alteration of enzyme specificity | Kd: 15 nM | University of Chicago | [1] | |