Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001210) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-Bcr-Abl Bcr-DH_4
|
|||||
| Synonyms |
Monobody Bcr-DH_4
|
|||||
| Molecular Weight | 10.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 5N7E | |||||
| Sequence Length | 95 | |||||
| SBP Sequence |
>Monobody anti-Bcr-Abl Bcr-DH_4
SVSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETGGNSPVQEFEVPGSKSTATI SGLKPGVDYTITVYAGSYAYEYYWGPSPISINYRT |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Breakpoint cluster region protein | Binder | Leukemia [ICD-11: 2B33.4] | Kd: 20 nM | Swiss Institute for Experimental Cancer Research (ISREC) | [1] | |