General Information of Synthetic Binding Protein (SBP) (ID: SBP001204)
SBP Name
Monobody anti-AurA clone 3
Synonyms
Mb3
Molecular Weight 10.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Counter selection screens
Highest Status Research
Sequence Length 95
SBP Sequence
>Monobody anti-AurA clone 3
GSVSSVPTKLEVVAATPTSLLISWDAMSDWYYWVDYYRITYGETGGNSPVQEFTVPGSYS
TATISGLKPGVDYTITVYASDDVWGDYSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Aurora kinase A
BTS Info
Inhibitor Tools for allosteric modulation of a human protein kinase Kd: 160 nM Brandeis University [1] , [2]
References
1 Allosteric modulation of a human protein kinase with monobodies. Proc Natl Acad Sci U S A. 2019 Jul 9;116(28):13937-13942.
2 A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain. Nat Struct Mol Biol. 2010 Apr;17(4):519-27.