Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001204) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-AurA clone 3
|
|||||
Synonyms |
Mb3
|
|||||
Molecular Weight | 10.6 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Counter selection screens | |||||
Highest Status | Research | |||||
Sequence Length | 95 | |||||
SBP Sequence |
>Monobody anti-AurA clone 3
GSVSSVPTKLEVVAATPTSLLISWDAMSDWYYWVDYYRITYGETGGNSPVQEFTVPGSYS TATISGLKPGVDYTITVYASDDVWGDYSPISINYRT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] , [2] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||