Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001203)
SBP Name
Monobody anti-AurA clone 2
Synonyms
Mb2
Molecular Weight 9.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Counter selection screens
Highest Status Research
PDB ID 6C83
Sequence Length 93
SBP Sequence
>Monobody anti-AurA clone 2
GSVSSVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYGETGGNSPVQEFTVPGSKSTAT
ISGLKPGVDYTITVYAIDFYWGSYSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2] , [3]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Aurora kinase A
BTS Info
Inhibitor Tools for allosteric modulation of a human protein kinase Kd: 1000 nM Brandeis University [1] , [2] , [3]
References
1 Allosteric modulation of a human protein kinase with monobodies. Proc Natl Acad Sci U S A. 2019 Jul 9;116(28):13937-13942.
2 A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain. Nat Struct Mol Biol. 2010 Apr;17(4):519-27.
3 Dynamics of human protein kinase Aurora A linked to drug selectivity. Elife. 2018 Jun 14;7:e36656.