Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001143) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-P-gp clone 592
|
|||||
Synonyms |
Nb592
|
|||||
Molecular Weight | 12.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli WK6 | |||||
Highest Status | Research | |||||
Sequence Length | 117 | |||||
SBP Sequence |
>Nanobody anti-P-gp clone 592
DVQLQESGGGLVQAGGSLRLSCAASGRTGSTYDMGWFRQAPGKERESVAAINWDSARTYY ASSVRGRFTISRDNAKKTVYLQMNSLKPEDTAVYTCGAGEGGTWDSWGQGTQVTVSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Chain A of PDBID 1HCV | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Phosphatidylcholine translocator ABCB4 | Inhibitor | Cancers [ICD-11: 2D4Z] | N.A. | The Scripps Research Institute | [1] | |