Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001143)
SBP Name
Nanobody anti-P-gp clone 592
Synonyms
Nb592
Molecular Weight 12.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli WK6
Highest Status Research
Sequence Length 117
SBP Sequence
>Nanobody anti-P-gp clone 592
DVQLQESGGGLVQAGGSLRLSCAASGRTGSTYDMGWFRQAPGKERESVAAINWDSARTYY
ASSVRGRFTISRDNAKKTVYLQMNSLKPEDTAVYTCGAGEGGTWDSWGQGTQVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Chain A of PDBID 1HCV
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Phosphatidylcholine translocator ABCB4
BTS Info
Inhibitor Cancers [ICD-11: 2D4Z] N.A. The Scripps Research Institute [1]
References
1 Structures of P-glycoprotein reveal its conformational flexibility and an epitope on the nucleotide-binding domain. Proc Natl Acad Sci U S A. 2013 Aug 13;110(33):13386-91.