Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001138) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-TM287/288 clone 36
|
|||||
Synonyms |
Sb_TM#36
|
|||||
Molecular Weight | 13.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 123 | |||||
SBP Sequence |
>Nanobody anti-TM287/288 clone 36
QVQLVESGGGSVQAGGSLRLSCAASGSISSITYLGWFRQAPGKEREGVAALSTSDGTTYY ADSVKGRFTVSLDNAKNTVYLQMNSLKPEDTALYYCAAATYGIWYPLTWWAYGYWGQGTQ VTV |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Convex scaffold | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Heterodimeric ABC transporter TM287/288 | Binder | Tools for the conformational trapping of membrane proteins | N.A. | University of Zurich | [1] | |