General Information of Synthetic Binding Protein (SBP) (ID: SBP001124)
SBP Name
Nanobody anti-TM287/288 clone 22
Synonyms
Sb_TM#22
Molecular Weight 13.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
Sequence Length 120
SBP Sequence
>Nanobody anti-TM287/288 clone 22
QVQLAESGGGLVQAGGSLRLSCAASGFPVHHQYMAWYRQAPGKEREWVAAIASWGGGTYY
ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDTGSWWEWYDYWGQGTQVTVS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Loop scaffold
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Heterodimeric ABC transporter TM287/288
BTS Info
Binder Tools for the conformational trapping of membrane proteins Kd: 868 nM University of Zurich [1]
References
1 Synthetic single domain antibodies for the conformational trapping of membrane proteins. Elife. 2018 May 24;7:e34317.