Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001081) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-CFTR G3a
|
|||||
Synonyms |
Nanobody G3a
|
|||||
Molecular Weight | 13.6 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
PDB ID | 6GKD | |||||
Sequence Length | 123 | |||||
SBP Sequence |
>Nanobody anti-CFTR G3a
QVQLQESGGGLVQAGGSLRLSCTASGRAFSWYVMGWFRQAPGKEREFVATVSGNGSRRDY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASSTYYYTDPEKYDYWGQGTQVT VSS |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Cystic fibrosis transmembrane conductance regulator | Binder | Cystic fibrosis [ICD-11: CA25.Z] | Kd: 1100 nM | Free University of Brussels | [1] | |