General Information of Synthetic Binding Protein (SBP) (ID: SBP001053)
SBP Name
Nanobody anti-GPC3 G8
Synonyms
Nanobody G8
Molecular Weight 13.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 123
SBP Sequence
>Nanobody anti-GPC3 G8
QVQLVESGGALVQPGGSLRLSCAASGLEVQWSDLRWYRQAPGKEREWVCGISWTPFFISY
EDSVKGRFTCSRDDARNTVYLQLNSLKPEDTAVYYCASQHSHAMAMHTKTLYWGQGTQVT
VSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Glypican-3
BTS Info
Binder Hepatocellular carcinoma [ICD-11: XH4W48] N.A. South-Central University for Nationalities; Chinese Academy of Sciences [1]
References
1 Identification of nanobodies against hepatocellular carcinoma marker glypican-3. Mol Immunol. 2021 Mar;131:13-22.