General Information of Synthetic Binding Protein (SBP) (ID: SBP001048)
SBP Name
Nanobody anti-TGP clone 66
Synonyms
Sb66
Molecular Weight 12.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Ribosome display; Phage display
Highest Status Research
Sequence Length 114
SBP Sequence
>Nanobody anti-TGP clone 66
QVQLVESGGGLVQAGGSLRLSCAASGFPVMENSMYWYRQAPGKEREWVAAITSQGSWTWY
ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCHVSVGTNYTGQGTQVTVS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name GFP-special nanobody Enhancer
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Green fluorescent GFP-like protein
BTS Info
Binder Research tool Kd: 7.8 nM University of Zurich [1]
References
1 An improved fluorescent tag and its nanobodies for membrane protein expression, stability assay, and purification. Commun Biol. 2020 Dec 10;3(1):753.