Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001047) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-TGP clone 44
|
|||||
| Synonyms |
Sb44
|
|||||
| Molecular Weight | 12.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Ribosome display; Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 114 | |||||
| SBP Sequence |
>Nanobody anti-TGP clone 44
QVQLVESGGGLVQAGGSLRLSCAASGFPVGRASMWWYRQAPGKEREWVAAISSYGWVTAY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCEVSVGTGYRGQGTQVTVS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | GFP-special nanobody Enhancer | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Green fluorescent GFP-like protein | Binder | Research tool | Kd: 4.4 nM | University of Zurich | [1] | |