Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001045) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-HIF-1A M3
|
|||||
| Synonyms |
Nanobody M3
|
|||||
| Molecular Weight | 13.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Prokaryotic cells | |||||
| Highest Status | Research | |||||
| Sequence Length | 128 | |||||
| SBP Sequence |
>Nanobody anti-HIF-1A M3
MVQLQESGGGSVQAGGSLRLSCVASGDTASMYCMGWFRQAPGKEREEVATIDSDGSVSIY DSLKGRFTISKDSANNALYLHMNSLRPEDTANYYCAAGRPPCGSWFLPGYYYYGMDYWGK GTLVTVSS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | VHH212 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hypoxia-inducible factor 1-alpha | Binder | Adenocarcinoma of pancreas [ICD-11: 2C10.0] | Kd: 1.5 nM | Tianjin University | [1] | |