Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001045) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-HIF-1A M3
|
|||||
Synonyms |
Nanobody M3
|
|||||
Molecular Weight | 13.9 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Prokaryotic cells | |||||
Highest Status | Research | |||||
Sequence Length | 128 | |||||
SBP Sequence |
>Nanobody anti-HIF-1A M3
MVQLQESGGGSVQAGGSLRLSCVASGDTASMYCMGWFRQAPGKEREEVATIDSDGSVSIY DSLKGRFTISKDSANNALYLHMNSLRPEDTANYYCAAGRPPCGSWFLPGYYYYGMDYWGK GTLVTVSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | VHH212 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Hypoxia-inducible factor 1-alpha | Binder | Adenocarcinoma of pancreas [ICD-11: 2C10.0] | Kd: 1.5 nM | Tianjin University | [1] | |