General Information of Synthetic Binding Protein (SBP) (ID: SBP001044)
SBP Name
Nanobody anti-HIF-1A clone 212
Synonyms
Nanobody 212
Molecular Weight 13.7 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Ribosome display
Highest Status Research
Sequence Length 128
SBP Sequence
>Nanobody anti-HIF-1A clone 212
MVQLQESGGGSVQAGGSLRLSCVASGDTASMYCMGWFRQAPGKEREEVATIDSDGSVSIA
DSLKGRFTISKDSANNALYLHMNSLRPEDTANYYCAAGRPPCGSIFKPGYYYYGMDYWGK
GTLVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Hypoxia-inducible factor 1-alpha
BTS Info
Binder Adenocarcinoma of pancreas [ICD-11: 2C10.0] Kd: 26.6 nM Tianjin University [1]
References
1 In vitro affinity maturation to improve the efficacy of a hypoxia-inducible factor 1 single-domain intrabody. Biochem Biophys Res Commun. 2020 Sep 3;529(4):936-942.