Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000891) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
RPtag anti-PDGFRbeta mutant
|
|||||
| Synonyms |
RPtag(large) H122L, A253R mutant
|
|||||
| Molecular Weight | 28.1 kDa | |||||
| Thermal Denaturation TEMP | 102 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Highest Status | Research | |||||
| Sequence Length | 265 | |||||
| SBP Sequence |
>RPtag anti-PDGFRbeta mutant
SQDPNSSSMKEGKTIGLVISTLNNPFFVTLKNGAEEKAKELGYKIIVEDSQNDSSKELSN VEDLIQQKVDVLLINPVDSDAVVTAIKEANSKNIPVITIDRSANGGDVVSLIASDNVKGG EMAAEFIAKALKGKGNVVELEGIPGASAARDRGKGFDEAIAKYPDIKIVAKQAADFDRSK GLSVMENILQAQPKIDAVFAQNDEMALGAIKAIEAANRQGIIVVGFDGTEDALKAIKEGK MRATIAQQPALMGSLGVEMADKYLK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | RPtag(Large) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS056 | [1] | ||||
| Scaffold Name | RPtag | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Platelet-derived growth factor receptor beta | Binder | Research tool | Kd: 15000 nM | Ichor Therapeutics, Inc; RecombiPure, Inc | [1] | |