Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000309) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
SWEEPin anti-ySUMO clone 31
|
|||||
| Synonyms |
SWEEPin SUMO-31
|
|||||
| Molecular Weight | 11.6 kDa | |||||
| Thermal Denaturation TEMP | 59.9 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 99 | |||||
| SBP Sequence |
>SWEEPin anti-ySUMO clone 31
GSGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPSMKKTIYDDYYVDRIKGY EYQLYVYASDKLFRADISEDYWSNGYRKLLRFNGPVPPP |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | scMonellin | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS059 | [1] | ||||
| Scaffold Name | SWEEPin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Yeast small ubiquitin-related modifier | Binder | Research tool | Kd: 3500 nM | Okayama University | [1] | |