General Information of Synthetic Binding Protein (SBP) (ID: SBP000060)
SBP Name
Monobody anti-ERBB1 clone 1
Synonyms
Adnectin 1
Molecular Weight 12.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method mRNA display
Highest Status Research
PDB ID 3QWQ
Sequence Length 108
SBP Sequence
>Monobody anti-ERBB1 clone 1
MGVSDVPRDLEVVAATPTSLLISWDSGRGSYQYYRITYGETGGNSPVQEFTVPGPVHTAT
ISGLKPGVDYTITVYAVTDHKPHADGPHTYHESPISINYRTEIDKPSQ
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epidermal growth factor receptor
BTS Info
Antagonist Tools as argeted biologics Kd: 2 nM Bristol-Myers Squibb Research & Development [1] , [2]
References
1 Structures of adnectin/protein complexes reveal an expanded binding footprint. Structure. 2012 Feb 8;20(2):259-69.
2 Anti-tumor effect of CT-322 as an adnectin inhibitor of vascular endothelial growth factor receptor-2. MAbs. Mar-Apr 2010;2(2):199-208.