Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000051)
SBP Name
Monobody anti-Abl-SH2 AS25
Synonyms
Monobody AS25
Molecular Weight 10.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System K562 Cells
Selection Method Yeast display
Highest Status Research
PDB ID 5DC4; 5DC9
Sequence Length 93
SBP Sequence
>Monobody anti-Abl-SH2 AS25
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGGWSGYQEFEVPGSKSTATIS
GLSPGVDYTITVYAYGYPYVKYNKSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2] , [3]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tyrosine-protein kinase ABL1
BTS Info
Inhibitor Research tool Kd: 20 nM University of Chicago [1] , [2] , [3]
References
1 Monobodies and other synthetic binding proteins for expanding protein science. Protein Sci. 2017 May;26(5):910-924.
2 Allosteric Inhibition of Bcr-Abl Kinase by High Affinity Monobody Inhibitors Directed to the Src Homology 2 (SH2)-Kinase Interface. J Biol Chem. 2016 Apr 15;291(16):8836-47.
3 Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold. J Mol Biol. 2012 Jan 13;415(2):393-405.