Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000047)
SBP Name
Monobody anti-Abl-SH2 SH13
Synonyms
Monobody SH13
Molecular Weight 10.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Yeast
Selection Method Phage display
Highest Status Research
PDB ID 3UYO
Sequence Length 95
SBP Sequence
>Monobody anti-Abl-SH2 SH13
GSVSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETGGNSPVQEFTVPGSKSTAT
ISGLSPGVDYTITVYAGYSDSWNWPYSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tyrosine-protein kinase ABL1
BTS Info
Binder Tools for identifying the unanticipated mode of monobody-target interactions Kd: 6800 nM University of Chicago [1]
References
1 Teaching an old scaffold new tricks: monobodies constructed using alternative surfaces of the FN3 scaffold. J Mol Biol. 2012 Jan 13;415(2):393-405.