Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000021) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-ySUMO clone 20
|
|||||
Synonyms |
ySMB-20
|
|||||
Molecular Weight | 11.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 103 | |||||
SBP Sequence |
>Monobody anti-ySUMO clone 20
GSSVSSVPTKLEVVAATPTSLLISWDAGYYMNYYMVDYYRITYGETGGNSPVQEFTVPGS SSTATISGLSPGVDYTITVYAYWYDEYGQYWWSESPSSINYRT |
|||||
3D Structure |
|
|||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Yeast small ubiquitin-related modifier | Inhibitor | Research tool | Kd: 66 nM | University of Chicago | [1] | |