General Information of Synthetic Binding Protein (SBP) (ID: SBP000021)
SBP Name
Monobody anti-ySUMO clone 20
Synonyms
ySMB-20
Molecular Weight 11.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 103
SBP Sequence
>Monobody anti-ySUMO clone 20
GSSVSSVPTKLEVVAATPTSLLISWDAGYYMNYYMVDYYRITYGETGGNSPVQEFTVPGS
SSTATISGLSPGVDYTITVYAYWYDEYGQYWWSESPSSINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Yeast small ubiquitin-related modifier
BTS Info
Inhibitor Research tool Kd: 66 nM University of Chicago [1]
References
1 Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design. Proc Natl Acad Sci U S A. 2011 May 10;108(19):7751-6.