Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00323) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Granulocyte-macrophage colony-stimulating factor
|
|||||
| Synonyms |
GM-CSF; Colony-stimulating factor; CSF; Molgramostin; Sargramostim
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
GM-CSF family
|
|||||
| Gene Name |
CSF2
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF ESFKENLKDFLLVIPFDCWEPVQE |
|||||
| Sequence Length |
144
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| scFv anti-GM-CSF clone 196 | Research | Binder | Kd: 1500 nM | Research tool | [1] | |
| scFv anti-GM-CSF clone 4 | Research | Binder | N.A. | Research tool | [1] | |
| scFv anti-GM-CSF clone 5 | Research | Binder | N.A. | Research tool | [1] | |
| scFv anti-GM-CSF clone 56 | Research | Binder | N.A. | Research tool | [1] | |