Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00319) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Cytochrome c
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Cytochrome c family
|
|||||
| Gene Name |
CYCS
|
|||||
| Organism |
Equus caballus (Horse)
|
|||||
| Function |
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW
KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE |
|||||
| Sequence Length |
105
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| scFv anti-CYT | Research | Binder | Kd: 0.35 nM | Research tool | [1] | |