Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00319) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Cytochrome c
|
|||||
BTS Type |
Protein
|
|||||
Family |
Cytochrome c family
|
|||||
Gene Name |
CYCS
|
|||||
Organism |
Equus caballus (Horse)
|
|||||
Function |
Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases (By similarity).
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Sequence |
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW
KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE |
|||||
Sequence Length |
105
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
scFv anti-CYT | Research | Binder | Kd: 0.35 nM | Research tool | [1] | |