Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00303) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Serine protease HTRA1
|
|||||
Synonyms |
EC 3.4.21.-; High-temperature requirement A serine peptidase 1; L56; Serine protease 11
|
|||||
BTS Type |
Protein
|
|||||
Family |
Peptidase S1C family
|
|||||
Gene Name |
HTRA1
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate MMP1 and MMP3 production. May also degrade proteoglycans, such as aggrecan, decorin and fibromodulin. Through cleavage of proteoglycans, may release soluble FGF-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Inhibits signaling mediated by TGF-beta family members. This activity requires the integrity of the catalytic site, although it is unclear whether TGF-beta proteins are themselves degraded. By acting on TGF-beta signaling, may regulate many physiological processes, including retinal angiogenesis and neuronal survival and maturation during development. Intracellularly, degrades TSC2, leading to the activation of TSC2 downstream targets.
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARD
ACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG SDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA PAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEA KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI KKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP |
|||||
Sequence Length |
480
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
VNAR anti-HTRA1 CK2 | Research | Binder | Kd: 550 nM | Research tool | [1] | |
VNAR anti-HTRA1 CK4 | Research | Binder | Kd: 450 nM | Research tool | [1] | |
VNAR anti-HTRA1 CK5 | Research | Binder | Kd: 290 nM | Research tool | [1] | |