Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00268) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Gastrin
|
|||||
| Synonyms |
Gastrin component I; Gastrin-52; G52; Big gastrin; Gastrin component II; Gastrin-34; G34; Gastrin; Gastrin component III; Gastrin-17; G17; Gastrin-14; G14; Gastrin-6; G6]
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Gastrin/cholecystokinin family
|
|||||
| Gene Name |
GAST
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
|||||
| Sequence Length |
101
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| scFv anti-Gastrin C4 | Research | Binder | Kd: 1000-5000 nM | Research tool | [1] | |
| scFv anti-Gastrin D5 | Research | Binder | Kd: 1000-5000 nM | Research tool | [1] | |
| scFv anti-Gastrin E5 | Research | Binder | Kd: 1000-5000 nM | Research tool | [1] | |
| scFv anti-Gastrin G7 | Research | Binder | Kd: 1000-5000 nM | Research tool | [1] | |
| scFv anti-Gastrin H10 | Research | Binder | Kd: 1000-5000 nM | Research tool | [1] | |