Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00155) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Prostate stem cell antigen
|
|||||
| BTS Type |
Protein
|
|||||
| Gene Name |
PSCA
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLN
CVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL |
|||||
| Sequence Length |
114
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Diabody anti-PSCA A2 | Research | Binder | N.A. | Tools for 18F-Immuno-PET; Imaging agent | [1], [2] | |
| References |
|---|