Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00148) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
B-cell antigen receptor complex-associated protein beta chain
|
|||||
| Synonyms |
B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b
|
|||||
| BTS Type |
Protein
|
|||||
| Gene Name |
CD79B
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
|||||
| Sequence Length |
229
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| DART MGD-010 | Phase II | Modulator | N.A. | Acute hepatitis A [ICD-11: 1E50.0];Systemic lupus erythematosus [ICD-11: 4A40.0] | [1] | |