Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00066) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Hepcidin
|
|||||
| Synonyms |
Liver-expressed antimicrobial peptide 1; LEAP-1; Putative liver tumor regressor; PLTR
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Hepcidin family
|
|||||
| Gene Name |
HAMP
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma. Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes ; Has strong antimicrobial activity against E.coli ML35P N.cinerea and weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT |
|||||
| Sequence Length |
84
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Anticalin PRS-080 | Phase II | Antagonist | Kd: 0.05 nM | Anemia [ICD-11: 3A9Z]; Functional iron deficiency [ICD-11: 5B5K.0] | [1], [2], [3] | |
| References |
|---|