Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00024) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Major surface glycoprotein G
|
|||||
| Synonyms |
Attachment glycoprotein G; Membrane-bound glycoprotein; mG
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Pneumoviruses glycoprotein G family
|
|||||
| Gene Name |
G
|
|||||
| Organism |
Human respiratory syncytial virus A (strain A2)
|
|||||
| Function |
[Isoform Membrane-bound glycoprotein G]: Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (Probable).; [Isoform Secreted glycoprotein G]: Helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAMIISTSLIIAAII
FIASANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTP GVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNP TCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTK TNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ |
|||||
| Sequence Length |
298
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affibody anti-Glycoprotein-G Z(RSV1) | Research | Binder | Kd: 1000 nM | Diagnostic reagent; Therapeutic application | [1] | |